SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150375744|ref|YP_001312340.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150375744|ref|YP_001312340.1|
Domain Number 1 Region: 135-384
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.68e-58
Family D-glucarate dehydratase-like 0.00052
Further Details:      
 
Domain Number 2 Region: 44-149
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.06e-28
Family Enolase N-terminal domain-like 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150375744|ref|YP_001312340.1|
Sequence length 389
Comment mandelate racemase/muconate lactonizing protein [Sinorhizobium medicae WSM419]
Sequence
MSDRVKKIESFTLTLPRDKPYLGKPRPGEEPNGRGYLVRKGNRTVYPTFDRSVLVRIETE
NGAVGWGETYGLVAPRATMEIIDDLLADFTVGRDPFDAAAIHDDLYDLMRVRGYTGGFYV
DALAAIDIALWDLAGKLAGMPVCKLLGGRRRDRIDAYISGLPEDTRGKRAELAASWQAKG
FSSFKFASPVADDGVASEIETLRERLGDGARIACDMHWAQTASEAIALIRAMEPHGLWFA
EAPVRTEDMEGLARVAASVPTAIAVGEEWRTVYDMVPRVARNALAIVQPEMGHKGITQFM
RIGECAHAHHIKIIPHATIGSGIFLAASLQASAALANVDCHEFQHSIFEPNRRLLDGDMD
CVEGQYILPTGPGLGVEPSKEALALLKRN
Download sequence
Identical sequences A6UFH7
gi|150375744|ref|YP_001312340.1| WP_011969230.1.29075 WP_011969230.1.61285 WP_011969230.1.7720 WP_011969230.1.89664 YP_001312340.1.44884 gi|150375744|ref|YP_001312340.1|NC_009620 366394.Smed_3592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]