SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150375749|ref|YP_001312345.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150375749|ref|YP_001312345.1|
Domain Number 1 Region: 95-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.54e-80
Family D-glucarate dehydratase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-31
Family Enolase N-terminal domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150375749|ref|YP_001312345.1|
Sequence length 382
Comment galactonate dehydratase [Sinorhizobium medicae WSM419]
Sequence
MKITKLTTYIVPPRWLFLKIETDEGVVGWGEPVVEGRALTVEAAVHELSDYLVGRDPFLI
EDHWNVLYRGGFYRGGAIHMSALAGIDQALWDIKGKALGQPVHSLLGGQCRDKIKVYSWI
GGDRPSDVANNARDVVARGFKAIKLNGCEEMQIVDTNEKIDRAVETIGTIRDAIGPNIGI
GVDFHGRVHRPMAKVLAKELEQFKLMFIEEPVLSENREALREIANHCSTPIALGERLYSR
WDFKSVLSDGFVDIIQPDLSHAGGITECRKIAAMAEAYDVALAPHCPLGPIALAACLQVD
AVSYNAFIQEQSLGIHYNEANDILDYISNKDVFAYEDGFVSIPQGPGLGIEVDEAYVMER
AKEGHRWRNPVWRHSDGSVAEW
Download sequence
Identical sequences A6UFI2
gi|150375749|ref|YP_001312345.1| 366394.Smed_3598 gi|150375749|ref|YP_001312345.1|NC_009620 WP_011969235.1.29075 WP_011969235.1.61285 WP_011969235.1.7720 WP_011969235.1.89664 YP_001312345.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]