SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150375857|ref|YP_001312453.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150375857|ref|YP_001312453.1|
Domain Number 1 Region: 4-244
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7e-85
Family ABC transporter ATPase domain-like 0.000000236
Further Details:      
 
Domain Number 2 Region: 237-348
Classification Level Classification E-value
Superfamily MOP-like 2.92e-20
Family ABC-transporter additional domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150375857|ref|YP_001312453.1|
Sequence length 349
Comment glycerol-3-phosphate transporter ATP-binding subunit [Sinorhizobium medicae WSM419]
Sequence
MATINLTDVHKTYQGDIAAIRGVSLAIADGEFIVLVGPSGCGKSTLLRMIAGLESITSGE
VSIGDRVVNGLEPSERDIAMVFQNYALYPHMTVRQNLSYGLKNRNTPKDEIERRIAKAAK
SLEIEPFLDRKPRQLSGGQRQRVAMGRAIVREPAAFLFDEPLSNLDAKLRVQMRVEIRRL
QRALATTSVYVTHDQLEAMTLADRLVVLNGGRIEQVGTPIELYEKPATAFVATFIGSPSM
NLLDIGSHDSAWTVPGGLVGKPGLATIGIRPEDITLADGSAGGDRFRARVRVGAVELVGA
ESYVHGTLTNGEPLVFRVAGRSRTAIDEELEVAAEPESLHWFDAAGRRL
Download sequence
Identical sequences A6UFU0
366394.Smed_3707 gi|150375857|ref|YP_001312453.1|NC_009620 WP_011969343.1.29075 WP_011969343.1.61285 WP_011969343.1.89664 YP_001312453.1.44884 gi|150375857|ref|YP_001312453.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]