SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150375924|ref|YP_001312520.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150375924|ref|YP_001312520.1|
Domain Number 1 Region: 799-1020
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.62e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.00059
Further Details:      
 
Domain Number 2 Region: 304-499
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.72e-41
Family Multidrug efflux transporter AcrB transmembrane domain 0.00011
Further Details:      
 
Domain Number 3 Region: 50-146
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.83e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0037
Further Details:      
 
Domain Number 4 Region: 147-192,278-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.02e-16
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.005
Further Details:      
 
Domain Number 5 Region: 713-797
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000157
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0031
Further Details:      
 
Domain Number 6 Region: 195-275
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000288
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.013
Further Details:      
 
Weak hits

Sequence:  gi|150375924|ref|YP_001312520.1|
Domain Number - Region: 564-646
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00146
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150375924|ref|YP_001312520.1|
Sequence length 1050
Comment acriflavin resistance protein [Sinorhizobium medicae WSM419]
Sequence
MQASTEDRKPFNLSRWAIGHPSIARFLLALIIITGALGLLRMGQREDPEFTFRVMVVQAV
WPGASIQEMEDQVVNKIERKLQETPHLDFVRSYTRAGSAIITVQIEGDTNADEVADAFYQ
VRKKVGDIANELPEGVLGPYFNDEFGDTFITLHSISGDGFSYPELRRFAIEGRDMLLTTP
GVEKVVILGDQPEKIFIDVSSKALAERGLTLNDLRDAIAGQNNVDHAGSIDTGTRSVRIS
VEGGVTKAEDIRELRLRAGERTIRLGDIATVTSGLEDPYSRKFRFNGHDSVQIGVVMAKG
FNVTDVGKAVEATYDRFESALPYGVSVDQVSNQPEVVTEAISEFSHALVEALIIVLVVSF
LSIGWRSGLVIAIAIPLVLAATFAIMYELGIDLQRISLGALIIALGLLVDDAMIVVEMME
RKLEEGLEKIDAASFAYSSTAFPMLTGTLITTAGFIPVGFAQSTAGEYVRSLFYVVGIAL
VVSWFVAVYFTPWLGYMILKQRHHAGTHHDVFDTRFYRRLRSTVGWAVRHRITVLLMTLA
IFMTSLWGFQFIPKNFFPQSSRPEILVDLWLPEGTSIKEVEKQAKALEQRLMDDKDKRFI
ATYIGEGAPRFFLPLDQQLRNPNFAQLLVMAKDEPARERLIGKLRTVLAEEFPSIRTKVD
RLFLGPPTGWPVQMRVMGPDREEVRRIANEVKAKFRENPLLGAIHDDWLEPVPAMKLVID
QDRARALGITSQRIRQMLQAAMSGVPLDSFRDGEEAVSIVAREPGGNRHLLSAVQSVYVP
TDFGGFVPVSQVAKVVPVMEQGVEWRRDRLPTITVRATLPDGVQSNDVAMKLFDELRGLR
DSLPPAYKVEIQGGAEDSAESQASIAAKAPIMLVVIVILLMVQLQHFGKAMLVLATGPLG
IIGAAAALLISGAPFGFVAILGVIALLGIIIRNSIILVDQIDQDIAAGMERYEAIIGAAV
RRFRPITLTALTAVLALIPISRGVFWGPLAYAMMGGILVATVLTIVVLPAAYALFFGKEP
KARKTAPGPAAAQGDADEDSTPYPAPLAAE
Download sequence
Identical sequences A6UG07
366394.Smed_3774 gi|150375924|ref|YP_001312520.1|NC_009620 YP_001312520.1.44884 gi|150375924|ref|YP_001312520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]