SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150375925|ref|YP_001312521.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150375925|ref|YP_001312521.1|
Domain Number 1 Region: 202-252
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000319
Family Tetracyclin repressor-like, N-terminal domain 0.06
Further Details:      
 
Domain Number 2 Region: 255-302
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000538
Family AraC type transcriptional activator 0.027
Further Details:      
 
Weak hits

Sequence:  gi|150375925|ref|YP_001312521.1|
Domain Number - Region: 63-163
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.00745
Family Regulatory protein AraC 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150375925|ref|YP_001312521.1|
Sequence length 318
Comment AraC-like transcriptional regulator [Sinorhizobium medicae WSM419]
Sequence
MSTIMFPQRNLREETAPLRAQILDRLSKLPWDGLSFEHPIPGLSLYRIIQPAGPFSSVYE
PSLSFIIKGSKNVRVGNETMVYDEGCFFLTAIGLPVTGQICAASEREPYVAAALRLDMEK
VRRIIADHDIHPTDLPERDLGVAVGTATCELFDALFRLISLAGAPADIPFLAGHIQNEII
YRLLTGEQGARLRRFALAGTNSNRVAKAVAWLKENYTKQLRVEELAEIANMGVSTLHHHF
RAMTAMSPLQFQKHLRLHHARELMLSQSLDAATAALRVGYESPTQFNREYRRAFGHPPLR
DIRAILNSNDSTRRSPAG
Download sequence
Identical sequences A6UG08
gi|150375925|ref|YP_001312521.1| gi|150375925|ref|YP_001312521.1|NC_009620 366394.Smed_3775 WP_011969411.1.29075 WP_011969411.1.61285 WP_011969411.1.89664 YP_001312521.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]