SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150375941|ref|YP_001312537.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150375941|ref|YP_001312537.1|
Domain Number 1 Region: 60-533
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1e-112
Family Arylsulfatase 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150375941|ref|YP_001312537.1|
Sequence length 548
Comment sulfatase [Sinorhizobium medicae WSM419]
Sequence
MKKEPIADQRDPRERANITRRSILLGGTAIAAASTVLTTGGAQTAQAQTQTQAPDAGGSA
KQPNILVIWGDDIGTWNISHNNRGMMGYKTPNIDRIAQEGLSFTDYYGQQSCTAGRAAFI
GGNVPVRTGMTKVGLPGAKEGWQETDVTMATVLKSQGYATGQFGKNHQGDRDEHLPTNHG
FDEFFGNLYHLNAEEEPENRDYPKDPEFRRRFGPRGVIHSFADGKIEDTGALTKKRMETI
DEESLAAAKDFITRQNQAGTPFFVWWNGTRMHFRTHVKAEHAGISGPSGDEYHDGMVEHD
MHVGELLKLLDELGIAENTVVMYSTDNGPHFNTWPDAATTPFRSEKNSNWEGAYRVPAFV
RWPARFPAGKTLNGIVAHEDWLPTFGAIAGAPDVKEKLLEGVELNGRRYRNYIDGYNQLE
YLEGKTDQSPRHEFWYVNDDGQVVAARYDDWKVVFLENRGEAFGVWREPFTELRVPLLFN
LRRDPFEKAQHNANTYDDWFLERAFVVVPIQGLAAKFLQTMKEYPPSQSPGSFNLTKIEE
SLKAGMRN
Download sequence
Identical sequences A6UG24
gi|150375941|ref|YP_001312537.1|NC_009620 gi|150375941|ref|YP_001312537.1| 366394.Smed_3791 WP_011969427.1.29075 WP_011969427.1.61285 WP_011969427.1.89664 YP_001312537.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]