SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150375954|ref|YP_001312550.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150375954|ref|YP_001312550.1|
Domain Number 1 Region: 56-480
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.93e-116
Family Arylsulfatase 0.00000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150375954|ref|YP_001312550.1|
Sequence length 552
Comment sulfatase [Sinorhizobium medicae WSM419]
Sequence
MSFPDADKRKNAQGSISIDRRSLLLGGTILAAAAAANGAVAVGSAKAQEQSSAGSGKTPN
ILVIFGDDIGIPQISAYTMGLMGYRTPNIDRIAAEGAIFTDAYGQQSCTAGRASFILGQE
PFRTGLLTIGMPGDPHGIQDWMPTIADVMKSKGYATGQFGKNHLGDRDEHLPTNHGFDEF
FGNLYHLNAEEEPEGYFYPKDEEFRKNFGPRGVIKSSADGKIEDTGALNTKRMETVDEEF
LAAAKDFIDRQAKADKPFFCWFNSTRMHVFTHLKPESMGKTGKGIHADGMVEHDGHVGQL
LQQLDDLGITENTIVLYTTDNGAELALWPDGAMTMFHGEKGTTWEGGFRIPMMVRWPGVV
KPGTQINDPVTLMDWMPTFATAAGIPDVKEEMKTGFKSGDKTFKVHLDGYDLTALLKGEA
EEPPREAVYYFDQGGNLNAIRWNDWKLSFAVNSEGNIATATRETPSWANIANLRMDPYER
GTKEGGGAMEFIARNMWLLVPIQSKIKEFFQDFDQYPYQPGSTLNASGINYNLLQQQAAL
KRLGDLERLAPR
Download sequence
Identical sequences A6UG37
366394.Smed_3805 WP_011969440.1.29075 WP_011969440.1.31871 WP_011969440.1.89664 YP_001312550.1.44884 gi|150375954|ref|YP_001312550.1| gi|150375954|ref|YP_001312550.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]