SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376108|ref|YP_001312704.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376108|ref|YP_001312704.1|
Domain Number 1 Region: 4-250
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.15e-82
Family ABC transporter ATPase domain-like 0.000000426
Further Details:      
 
Domain Number 2 Region: 244-364
Classification Level Classification E-value
Superfamily MOP-like 0.00000000000111
Family ABC-transporter additional domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150376108|ref|YP_001312704.1|
Sequence length 378
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MPTINLRGAQKNYGVNSANAVSDLDLEIRDGEFMCLLGPSGCGKTTTLRMIAGLENLSGG
EIRVGDRVVDCVSGGVFVPPEKREMGLVFQSYALWPHLTIERNTDFGLRLRKLPKAEREE
RVERVMQALDIAKYRDRYPSQLSGGQQQRVALARMLAINPGVLLLDEPLSNLDARLRLEM
RAELKRLHKEFKTTIVFVTHDQWEAMTLATTIAVMNEGTLQQIGTPNDIYDRPANRFVAE
FVGSPPINILDFGDPGTSDVTDKAEAYLAAHLPGLRSIGSVGIRPEAIGYAARTEDVPEG
SFSGETTVTGVLPTGGNWILELRTDNHTLFLTTHVPPRVEQGARVLFFAPPEALHVFDAD
GRRIAEADDRLRSTATYN
Download sequence
Identical sequences A6UGJ1
366394.Smed_3962 WP_011969593.1.29075 WP_011969593.1.61285 WP_011969593.1.89664 YP_001312704.1.44884 gi|150376108|ref|YP_001312704.1|NC_009620 gi|150376108|ref|YP_001312704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]