SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376150|ref|YP_001312746.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376150|ref|YP_001312746.1|
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.13e-50
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 180-285
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 3.79e-28
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376150|ref|YP_001312746.1|
Sequence length 287
Comment FAD-binding molybdopterin dehydrogenase [Sinorhizobium medicae WSM419]
Sequence
MKPFEYYEPATLAEASELLRRLGKDASIIAGGTDLLVELKEDLRSAHHIVNIKKIPGLTD
FAYDPANGLRFGALVTVREIETSPAVNGNYPNLAKAVSLLGSIQVRNRATVVGNICRASP
SADTIPPLIADGASLSVYSGGTERSIPLDEFFTGPGRTVLVPGDIVTGISMPAPRPTSGR
AYIKHGRRKAMELATVGVAVSMEHVAGQCSDIRIALGAVAPTVIRARRTEDLLRGRMIDA
ALLAEAAESAMQEATPIGNVRASAAYRRDMVGVLTRRAIGYAMGGVQ
Download sequence
Identical sequences A6UGN3
gi|150376150|ref|YP_001312746.1|NC_009620 366394.Smed_4005 gi|150376150|ref|YP_001312746.1| WP_011969635.1.29075 WP_011969635.1.31871 WP_011969635.1.61285 WP_011969635.1.89664 YP_001312746.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]