SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376183|ref|YP_001312779.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376183|ref|YP_001312779.1|
Domain Number 1 Region: 5-318,347-458
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.29e-108
Family Amylase, catalytic domain 0.00000262
Further Details:      
 
Domain Number 2 Region: 465-539
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000702
Family alpha-Amylases, C-terminal beta-sheet domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376183|ref|YP_001312779.1|
Sequence length 544
Comment alpha amylase catalytic protein [Sinorhizobium medicae WSM419]
Sequence
MNEAPWFTSSVIYGIDVRRFADGNGDGIGDFIGLRERVVYLSHLGIDCVWLSPFFRSPFA
DNGYDVSDYYSVDPALGTLDDFLNFLHAAGEHGIRVIIDLVANHTSSEHPWFQAARRDAR
CRFRDYYVWSASPPPVAPDNKTAFPGEESSVWTYDELAQAYYFHKFRHFQPDLNIANPAV
RDELLRVVDYWLTLGVDGFRVDAAPFVIGETGIEHADPRDPHGFLREMRELVEGRRRDGL
LLGEADLSPEKLRPYFGEGKLDLLFNFVLSASFAASLARQKADLIGQALSIMPEPPPHRG
WVNFLRNLDELNLDRLPEDIQQETFAAFAPDEEMRIYGRGIRRRLAPMLEGNQTRLELAF
SLLLSSPGVPLVLYGDEIGMGEDPSRPGREPVRVPMQWNAGANAGFSTAQRARLIQPIVT
DGPFAFKRINVEAQREDPRSLLNRVRAMILMRRSHKLFQRGRPIVLHTRDPALFALAYSD
GTELFVVLHNLTEAKRRAEVELPGAIDARLKDVFGEGEVELSGQHLTMGLGPFGYAWLHS
GRKD
Download sequence
Identical sequences A6UGR6
gi|150376183|ref|YP_001312779.1|NC_009620 WP_011969668.1.29075 WP_011969668.1.61285 YP_001312779.1.44884 366394.Smed_4038 gi|150376183|ref|YP_001312779.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]