SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376185|ref|YP_001312781.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376185|ref|YP_001312781.1|
Domain Number 1 Region: 17-193
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.72e-40
Family FAD-linked oxidases, N-terminal domain 0.023
Further Details:      
 
Weak hits

Sequence:  gi|150376185|ref|YP_001312781.1|
Domain Number - Region: 169-396
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 0.000275
Family Cytokinin dehydrogenase 1 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376185|ref|YP_001312781.1|
Sequence length 409
Comment FAD linked oxidase domain-containing protein [Sinorhizobium medicae WSM419]
Sequence
MANTPWSATSKNLDQDCHNWSGGLRFRPARLEVPEHEEAVAALVRAAGRQGRTIRPVGSA
HSSSEIYVTDDVLVSLANICGLHEHDSRCHRAAVGAGSQLTELSKELQSAGMTLSNFGDV
ATQTVGGAIGTGTHGSGRNFPNLSMMLVGGRLVTARGEITTFGVEEDLDFVRALRVSFGT
LGILTSATLQLEPLHDLRRQEWCLGFEPCMEALDRLSRENRNFDFYWYPRSDEVKIRCLN
PPGEEKTYGAFARLAKDETGPPHEVIPQHSDLPYRFEEMEYSMPAEAGPDCMRKLRTRIK
EKWRRSVGWRVLYRYIKRDDTWLSEAYGRDSVSISLHQNATLPYWDFFLDLEPVMRDHGG
RPHWAKKHSLRATELKALYPMWDRFLALRQELDPEGRFLTPYLRRLLGC
Download sequence
Identical sequences A6UGR8
gi|150376185|ref|YP_001312781.1| 366394.Smed_4040 WP_011969670.1.29075 WP_011969670.1.89664 YP_001312781.1.44884 gi|150376185|ref|YP_001312781.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]