SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376211|ref|YP_001312807.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376211|ref|YP_001312807.1|
Domain Number 1 Region: 403-489
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000184
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150376211|ref|YP_001312807.1|
Sequence length 502
Comment sulfate transporter [Sinorhizobium medicae WSM419]
Sequence
MRRKSMKLTFTSYKREWFSNIRGDVLSGIVVALALIPEAIGFSVIAGVDPKVGLFASFAI
ACVSAFTGGRPGMISAATAATAVLMVTLVKEYGLEYLFAATLLMGLIQIAAGFLKLGRVM
RFVSRSVITGFVNALAIMIFMAQLPELIGVPHVTYAMIGAGLAIIYLFPYVTKAVPSPLV
AIAALTAIAVWTGMDIRTVGDLGELPSSLPIFALPQVPLTFETLQIVFPYSVGLAAVGLL
ESLLTAQIVDDMTDTTSNKSQECIGQGASNIASGLIGGMGGCAMIGQSVINVTSGGRGRL
STFVAGALLLFLILVLDDIVRIIPMAALVAVMIMVSIGTFSWRSILDLRRNPLPSSVVML
ATVVTTVGTHDLAKGVLVGVLLSGIFFAGKVARLFHVRSILDQSGRERTYYVDGQIFFAS
TEGFVGAFDFAEPLDKVVIDVSGAHLWDITAVGALDKVVLKYRRHGVAVEVIGLNEASAH
MLDRFAVHDKSEEAGAALTPAH
Download sequence
Identical sequences A6UGU4
WP_011969696.1.29075 WP_011969696.1.61285 YP_001312807.1.44884 gi|150376211|ref|YP_001312807.1| 366394.Smed_4067 gi|150376211|ref|YP_001312807.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]