SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376214|ref|YP_001312810.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376214|ref|YP_001312810.1|
Domain Number 1 Region: 38-191
Classification Level Classification E-value
Superfamily Aromatic compound dioxygenase 3.66e-47
Family Aromatic compound dioxygenase 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150376214|ref|YP_001312810.1|
Sequence length 192
Comment intradiol ring-cleavage dioxygenase [Sinorhizobium medicae WSM419]
Sequence
MLPTRRSLLTAFLAVPALPVCNRAAAQQPTLPLTPACRDDDDLTPALTAGPFYKPDAPLR
HDLSGDAPDGERITIAGYVLDGNCRPIARSLVEIWHADETGAYDTRGYRLRGHQVTDERG
RWWFSTIIPALYPGRTRHYHFRVRRPGAPVLTTQLFFPNEPQNDGDRLYSPSLLLDLRDT
EDGKFGRFDFVV
Download sequence
Identical sequences A6UGU7
gi|150376214|ref|YP_001312810.1| 366394.Smed_4070 gi|150376214|ref|YP_001312810.1|NC_009620 WP_011969699.1.29075 WP_011969699.1.61285 YP_001312810.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]