SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376230|ref|YP_001312826.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376230|ref|YP_001312826.1|
Domain Number 1 Region: 1-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.18e-38
Family G proteins 0.00078
Further Details:      
 
Domain Number 2 Region: 435-549
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-35
Family Translational machinery components 0.0000757
Further Details:      
 
Domain Number 3 Region: 552-642
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000012
Family EF-G/eEF-2 domains III and V 0.0023
Further Details:      
 
Domain Number 4 Region: 358-432
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000396
Family EF-G/eEF-2 domains III and V 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150376230|ref|YP_001312826.1|
Sequence length 653
Comment elongation factor G [Sinorhizobium medicae WSM419]
Sequence
MRCFTVLGPSQIGKSTLVERVGSLEGEPKKSVTPYGLGLVEFEFGGEVWCALDVSGNNEA
LAHAQHALLASDACVLCVSPVLEGAVLAAPYLRMIEASGTPCILFVNRMDEPRGRIRDIV
AALQDFCSRPLILRQVPIREGDKIIGSCDLISERAWRYREGQPSSLFEIPESAAERENEA
RAELLEHLSEFDDWLLEELIEDRAPGSDAIYSISTRVLNENKIIPVLLGSASHSNGLMRL
MKALRHEAPRAEALRKRLAAGAGVGEANLLAVSFHAHYRQSVGKTVLARALQNGVKQGAA
LGGSSLGALQDPASGRPIGSGVTEAGQLFAAVKSDHLPVPSLLTAGAALAPPDWTTPPTP
MLERILVPASERDETKLSETLAKLAETDRGLNVMQEEGTGAQLVCAQGPVHLREVCRMLS
DVFHVEVSDRPPSPVYRETVSKSSEVHYRHRKQTGGAGQFADVKLSVHPNGRGDGFSFAE
TVKGGAVPRNFIPAVEAGAREAMEKGPLGFKVIDVGVMLTDGQHHSVDSSEYAFRTAGKL
GVRQALSQAASVLMQPVFRVDVHVPSIYSGSLVPIVASLKGQVLGFDRDEEAKGWDIFRA
LLPGSALDDLARSLRSATQGIGYFAKSFDHFEELYGKEAQAIVTAHGAPANEH
Download sequence
Identical sequences A6UGW3
366394.Smed_4086 gi|150376230|ref|YP_001312826.1|NC_009620 gi|150376230|ref|YP_001312826.1| YP_001312826.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]