SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376234|ref|YP_001312830.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376234|ref|YP_001312830.1|
Domain Number 1 Region: 71-164
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 2.09e-17
Family ParB-like nuclease domain 0.015
Further Details:      
 
Domain Number 2 Region: 157-217
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.000000209
Family KorB DNA-binding domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376234|ref|YP_001312830.1|
Sequence length 333
Comment parB-like partition protein [Sinorhizobium medicae WSM419]
Sequence
MARKNLIGISDSSAAPGDGERPAVGRPIAGLASQRSNGLVGGITRSLSNITQKVERAEEL
ERQLVEGHAIVELEPALIDSSFIIDRLGVAPEVQAMLVQQIRDHGQQVPILVRPHPTESG
RYQVAYGHRRLAALREIGSRVKAVIRELSDEQLVISQGQENNARTDLSFIERALFAARLE
DRGFSRDTIMSALGVDKAALSKMIAVVRRLPLDVIEAIGAAPGFGRRRWMDLADLIDTAE
RRSKALDFIGAAEFQALESDQRFDKLFALLSRARKPSKAEAWIAPDRSRPVRIRDTDAEM
MLAFSKKAAPGFADFVRQRLEALYLEYQRETGD
Download sequence
Identical sequences A6UGW7
366394.Smed_4090 gi|150376234|ref|YP_001312830.1| WP_011969719.1.29075 WP_011969719.1.31871 WP_011969719.1.61285 WP_011969719.1.89664 YP_001312830.1.44884 gi|150376234|ref|YP_001312830.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]