SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376394|ref|YP_001312990.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376394|ref|YP_001312990.1|
Domain Number 1 Region: 557-864
Classification Level Classification E-value
Superfamily Autotransporter 9.29e-42
Family Autotransporter 0.023
Further Details:      
 
Domain Number 2 Region: 91-481
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.04e-28
Family Virulence factor P.69 pertactin 0.0058
Further Details:      
 
Domain Number 3 Region: 487-543
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000154
Family beta-sandwich domain of Sec23/24 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376394|ref|YP_001312990.1|
Sequence length 864
Comment outer membrane autotransporter [Sinorhizobium medicae WSM419]
Sequence
MPDISPGRTSFAASDRALRRLSILNAHVLPGAPSASSDRIRCEFNKLLLGSVASIALFCS
LDSEARAACVETSPGAYDCSGTGPGPTFTGQSVTINADPTASFTSDVSITGPGTSTLNNN
GTLTNSLRATDNDRFTLNNRGLIDGTIFLGGSGANVIINYAGGDVQNGVTSTGDSHDTVI
NRGFFAGSIVLGDGYDVLGLIEGTVQTSVDMGAGDDQFTWLVGNIAATVQMGEGDDRAVF
GSLTQQNLSAGKRVDGGLGIDTLVWENTTNDDGGGSGDHPENIVNWEEIELRNGSEMTFI
YSTGNLTLGDSASGTGTLSIDETSAVRAGNSFGYGVRAFDPSQLVTVYNAGIIDMTNDTV
NVGDLLHDTFTVYGNYVGQQGGLQLHTVLESDDAPSDKLVISGTGASASGGTSILITNVG
GQGALTLADGIRVVDATAGATTEGTAFTLGAPVAAGIFEYKLYRGGLTEDPDNDDDWFLR
SGGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPIT
PSVRPEIPGYIVKPALMQKMGVAAIGTFHERQGDQFLLNSNGYLPGAWGRLFGESFDQSW
SSKISRFEFEVSPSSSGELWGLQAGQDLIGALHDDGSQDRVGVFFAYTGTSGSNGGNTLG
RLQVESGSIDLHANSIGAYWTHIGADGWYVDSIGMYSWLDGGSNSDRGIGVDTSGNSTAL
SIEAGYPFRFDNGWVLEPQGQLIWQHVDLDDANDRFTGIDYESFGTWTGRLGVRLEANTT
MNDVPVQPFASVNLWHDFDQDYKVSFNRVPVVTELEQTLLELNVGFSAQMSETVSVYGGL
QFATGLDDDDNRGYGGNIGLRIKW
Download sequence
Identical sequences A6UHC7
366394.Smed_4252 gi|150376394|ref|YP_001312990.1| gi|150376394|ref|YP_001312990.1|NC_009620 YP_001312990.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]