SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376503|ref|YP_001313099.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376503|ref|YP_001313099.1|
Domain Number 1 Region: 298-500
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.14e-49
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000273
Further Details:      
 
Domain Number 2 Region: 805-1027
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.1e-41
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000107
Further Details:      
 
Domain Number 3 Region: 565-671
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.62e-26
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00066
Further Details:      
 
Domain Number 4 Region: 39-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.88e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000653
Further Details:      
 
Domain Number 5 Region: 137-183,276-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.96e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0024
Further Details:      
 
Domain Number 6 Region: 184-273
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.53e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00025
Further Details:      
 
Domain Number 7 Region: 722-806
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.57e-20
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376503|ref|YP_001313099.1|
Sequence length 1065
Comment hydrophobe/amphiphile efflux-1 (HAE1) family protein [Sinorhizobium medicae WSM419]
Sequence
MISEIFIDRPRFAAVISIVLTLAGLIALTRLPVAQFPDIVPPQVSITASYPGAGADVVEA
TVAQPIESKVVGVDDMLYMKSTSGADGTYSLTVTFAVGTDPDIATVNVQNRVALAEPVLP
AEVKQSGVSVQKRSSSLMQVIAIHGENDEFDNLFLSNYATINVLDTIKRVPGVGDATLFG
AQDYSMRIVLDIDRLTNLGLTPTDVINALKAQNVQAAIGRIGAQPMTDDPLFQLNIQTQG
RLTDPAQFGDVVLRAGADGSFVRIRDVAHVELGSVSSDSTARINGKPVAMIGTYQAPGAN
ALAATEGVQQALERLSAAFPEGLTYSVSYDTSDFVQASVENVEHTLLEAFALVIIVVFLF
LGNWRATLIPLIAVPVALVGTFAVILAMGFSLNTVSLLALVLAIGIVVDDAIVVVENVER
VMEENPGMSAAEASRLAMGEITGAIVAITLVLLSVFVPVAFIPGLSGQLFQQFAVAVSVS
MVISAINALTLSPALCAILLKPHHGPKRGVLGWISRGIDRTRNGYAHLAGGIARRAILGL
VLLAVAIGASGWLFRIVPTGFLPSEDQGAFFAEIRLPEGASFNRTDAVVRQVESLLGSIE
GVANVTTVTGYSFLDGIAKSSSAFAIVTMKPFAERESETASVNAAIATVMAQGAAIRNAQ
VFAFNLPPIIGLGTGSGFEYQLLDLQGRSPAELAATAGGLMVAANQNPQLGPTFSTYSAS
SPQLYLDLDRDRLQALGVSVSDLFATLQGTLGSYYVNDFNLFGRSWKVTMQAAETDRDAV
EDISRLHVRNAAGDMVPVASVARVNYIVGPQSIVRYNNYRSITLNGQPAPGVSSGQALAA
MEQISAATLPPGYSFEWTGTALQELEAAGQTTVILALAVFFAYLFLVALYESWTIPIPVL
LSVSVGVAGALVAVLLAGLSFDIYAQIGLVVLIALASKNAILIVEFAKFQREKGVPIVDA
AVEGARTRFRAVMMTSFAFIVGLVPLVTAEGAGMLSRRAVGTGVAGGMLAASLLGIFIIP
ALYVVFQWLRERGHKLAGLSSHAAVEAPRKGELEESIERDRNVAD
Download sequence
Identical sequences A6UHN6
366394.Smed_4361 gi|150376503|ref|YP_001313099.1| YP_001313099.1.44884 gi|150376503|ref|YP_001313099.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]