SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376537|ref|YP_001313133.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376537|ref|YP_001313133.1|
Domain Number 1 Region: 4-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.51e-85
Family ABC transporter ATPase domain-like 0.000000191
Further Details:      
 
Domain Number 2 Region: 236-356
Classification Level Classification E-value
Superfamily MOP-like 1.02e-19
Family ABC-transporter additional domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150376537|ref|YP_001313133.1|
Sequence length 370
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MASVTLRNVSKTFGTYDVIRSIDLEIEDGEFVVFVGPSGCGKSTLLRLIAGLVPVSGGDV
FIGGDQVTDVPASKRGLAFVFQSYALYPHMNVARNIGFALETARLGKDEMRRRVARVADM
LKIGHLLERRPRQLSGGQRQRVAIGRALVGQPEVFLFDEPLSNLDADLRMEMRFEIAKLH
ADVRTTMIYVTHDQTEAMTLADRIVILNHGKIEQVGRPRALYDRPANRFVAGFLGSPRMN
FAPLETAGAAVSMLRGAGGFTYAADLAAAEGTPVELGLRPESLQLVGADVKGAIRGTFER
MEDLGYEYVCYVRLTETLVWTIRATGSPPQITPGEPVGLTWQPESLYLFGEDGRRIDHRT
SIPLSLGASS
Download sequence
Identical sequences A6UHS0
YP_001313133.1.44884 gi|150376537|ref|YP_001313133.1|NC_009620 366394.Smed_4396 gi|150376537|ref|YP_001313133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]