SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376550|ref|YP_001313146.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376550|ref|YP_001313146.1|
Domain Number 1 Region: 142-476,505-578
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.54e-124
Family Amylase, catalytic domain 0.000000291
Further Details:      
 
Domain Number 2 Region: 14-152
Classification Level Classification E-value
Superfamily E set domains 5.88e-46
Family E-set domains of sugar-utilizing enzymes 0.00095
Further Details:      
 
Domain Number 3 Region: 593-688
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000000129
Family alpha-Amylases, C-terminal beta-sheet domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376550|ref|YP_001313146.1|
Sequence length 695
Comment glycogen debranching protein GlgX [Sinorhizobium medicae WSM419]
Sequence
MNLAFTELDFIKPELGADYTGQGTHFAVFSAHAEKIELCLFSEDGREETARMPLPKREGD
VWSGYIEGIGPGALYGYRAHGPYDPHKGHRFNPNKLLLDPYAKQVAGELIWDDALFGYTI
GSPDGDLSFDERDSAPFMVKGVVQDPAFDWAGEEAIRRPWTETVIYEAHVRGMTMTHPAV
PDELRGTFLGMASDPIIEHLVKLGVSAIELMPVQYFLDDRYLIERNLRNYWGYQTLGFFA
PHKRYLRGDRITEFKTMVKRFHAVGIEVLMDVVYNHTAEGSERGPTLSFRGLDNFSYYRQ
SPDKPRHTYDTTGTGNTLNVAHPLVLRMVLDSLRYWVGVMHIDGFRFDLASTLGREYMEF
DREGGFFDAIRQDPILAGVKLIAEPWDVGQGGYQLGGFPPPFREWNDQFRDDVRRFWRGD
AGMVPVLAERLVGSPVQFRHSDRAATSSINLVSAHDGFTLMDTVSYGEKHNEANGEENRD
GHSDNHSDNMGAEGPTDNAEVNEARRRRRAAMVATLMVSQGVPMVLGGDELGNSQRGNNN
AYCQDNEIGWLDWPGADEGFLDFCRKLIAFRKQSPVLRQERFLDGEPDENGRVEIAWYKA
DGTPMDEDAWHTGELRLICAYICRTGQDEASPVGEIVVVLNAGEGCEIVLPHANGTKHWL
RVLDTAAEEPFDMRASADRESIPAQSLVAYVPQEG
Download sequence
Identical sequences A6UHT3
gi|150376550|ref|YP_001313146.1|NC_009620 WP_012061347.1.29075 WP_012061347.1.61285 YP_001313146.1.44884 366394.Smed_4409 gi|150376550|ref|YP_001313146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]