SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376562|ref|YP_001313158.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376562|ref|YP_001313158.1|
Domain Number 1 Region: 29-220
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.94e-55
Family FAD-linked oxidases, N-terminal domain 0.016
Further Details:      
 
Weak hits

Sequence:  gi|150376562|ref|YP_001313158.1|
Domain Number - Region: 185-260,384-464
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 0.000105
Family Cytokinin dehydrogenase 1 0.026
Further Details:      
 
Domain Number - Region: 245-303
Classification Level Classification E-value
Superfamily Inhibitor of vertebrate lysozyme, Ivy 0.0471
Family Inhibitor of vertebrate lysozyme, Ivy 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376562|ref|YP_001313158.1|
Sequence length 479
Comment FAD linked oxidase domain-containing protein [Sinorhizobium medicae WSM419]
Sequence
MNDMSLTNLQNGITMVSAAAIEAFAGRLRGRVLMATDAAYDEARTVWNGMIDRRPGLIVQ
CAGAADVVNAVRFAAENQLLLAVRGGGHNIAGNAVCDGGLVIDLTPMKSIRVDQTTKTAW
VEPGATLAEVDMETQAFRLGLPTGINSTTGIAGLTLGGGFGWITRKFGLTIDNLLSADVV
TANGELVRASPTEHRDLFWAIRGGGGNFGVVTAFEFRLHELGPEVLSGLVVHPFADAESV
LQQYRQALENAPDELTCWVVMRQAPPLPFLPADWHGKEVVVLAMCHCGDLEAGEKAMAGL
RAIGNPIADVVSPHPFAGWQQAFDPLLAPGARNYWKSHDFMELSDQAIGVLTEAIRKLPG
PECEIFIGHVGGAAGRVAAEETAFPQRSSHFVMNVHGRWRDPDQDQVCIDWARHLFEAAK
PYAAGTAYVNFMPEDEIDRVEAAYGANYGRLVEIKRRYDPLNLFRMNQNVRPIQERGAA
Download sequence
Identical sequences A6UHU5
gi|150376562|ref|YP_001313158.1|NC_009620 YP_001313158.1.44884 366394.Smed_4422 gi|150376562|ref|YP_001313158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]