SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376658|ref|YP_001313254.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376658|ref|YP_001313254.1|
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily Nudix 1.25e-20
Family MutT-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150376658|ref|YP_001313254.1|
Sequence length 156
Comment NUDIX hydrolase [Sinorhizobium medicae WSM419]
Sequence
MPKRSAGILLYRYEAGNLLVLLVHPGGPFWSNRDVGAWSIPKGEYDAAEEPEAAARREFL
EETGIAIGGPLEFLGEERQKSGKLVTAYAHESEFDVDSLRSNVFETEWPPRSGQMQSFPE
VDRAAWFTPAEARRRINASQRPFIDRLEALRSRRAP
Download sequence
Identical sequences A6UI41
gi|150376658|ref|YP_001313254.1| 366394.Smed_4521 YP_001313254.1.44884 gi|150376658|ref|YP_001313254.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]