SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376677|ref|YP_001313273.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376677|ref|YP_001313273.1|
Domain Number 1 Region: 2-213
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.13e-68
Family FAD-linked oxidases, N-terminal domain 0.0034
Further Details:      
 
Domain Number 2 Region: 186-452
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.13e-48
Family D-lactate dehydrogenase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150376677|ref|YP_001313273.1|
Sequence length 456
Comment FAD linked oxidase domain-containing protein [Sinorhizobium medicae WSM419]
Sequence
MSVIEELMAALGNAVLTGDRITERYRSDASLSGRTLPLAVVRPGSVDEVAVALKICNAHG
QCVVPQGGLTGLAGGANPRAGDIAVSLERLSGIEEVDATASSMTVLAGTPLEVAQRAAED
AGFLLPIDLGARGSCQIGGNLATNAGGIRVIRNGVARDNVLGLEAVLADGTVVSSMNKMI
KNNTGYDLRQLFIGSEGTLGIITRAVLRLRPLPTGRLTALCALDSYSEVVTLLKRAQQEL
PGLGAYEAMWESYFRFNSEADGLRLFESCPAFAVIVEQDLQGHDAESERFEAFLGRALED
GVIGDALVAQSQKEAQAFWRIREGHALDRLPLLLNFDVSLAIGDIGRFADECGQALRAKF
PEAHVSFFGHVGDSNLHIAFSDPGATEETIHAVDDIVYALVGTYRGSVSAEHGIGLLKRD
FLHYSRSPAELELMRRIKSALDPNGILNPGKVLGSV
Download sequence
Identical sequences A6UI60
gi|150376677|ref|YP_001313273.1| YP_001313273.1.44884 gi|150376677|ref|YP_001313273.1|NC_009620 366394.Smed_4540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]