SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376678|ref|YP_001313274.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376678|ref|YP_001313274.1|
Domain Number 1 Region: 3-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.21e-86
Family ABC transporter ATPase domain-like 0.00000124
Further Details:      
 
Domain Number 2 Region: 240-345
Classification Level Classification E-value
Superfamily MOP-like 0.0000476
Family ABC-transporter additional domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376678|ref|YP_001313274.1|
Sequence length 367
Comment sulfate ABC transporter ATPase [Sinorhizobium medicae WSM419]
Sequence
MEVRVQNIRKEFARFPALDNVSLDIRSGELIALLGPSGSGKTTLLRLVAGLESPTGGTIF
FGDDDASKKTVQERNIGFVFQHYALFRHMTVLDNVAFGLKVRTAKRRPPAAEIRRRALDL
LDLVQLSGLEKRYPAQLSGGQRQRVALARAMAVEPNVLLLDEPFGALDAQVRKELRRWLR
EIHDRTGHTTIFVTHDQEEALELADRVVVMSKGTIEQVGSPDEIYDHPVSPFVYGFIGQS
NCLDVTLANGEIWLEDRPIGLRAANEPDGPATLYFRPHDVELIDGCGGCLAGLVTASRRV
AGTRHLELELGRTHPRVEIELPPERAAFADHTRIAFRPTRWKLFQKGERRITAREEVVVP
ELEATGT
Download sequence
Identical sequences A6UI61
366394.Smed_4541 gi|150376678|ref|YP_001313274.1|NC_009620 WP_012061474.1.29075 WP_012061474.1.61285 YP_001313274.1.44884 gi|150376678|ref|YP_001313274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]