SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376753|ref|YP_001313349.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376753|ref|YP_001313349.1|
Domain Number 1 Region: 12-299
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.61e-84
Family PA1517-like 0.0000000244
Further Details:      
 
Domain Number 2 Region: 309-470
Classification Level Classification E-value
Superfamily UraD-Like 1.05e-53
Family UraD-like 0.00000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150376753|ref|YP_001313349.1|
Sequence length 471
Comment chitin deacetylase [Sinorhizobium medicae WSM419]
Sequence
MRYPRDLLGHGPNPHIAWPDGARIAVQFVINYEEGGENCVLHGDAASEAFLSEIVGAQAW
PAQRHWNMESIYEYGARAGFWRLHRLFTERQIAATVYGVATALKRSPAQVAAMQEAGWEI
ASHGLKWIEHKDFDAERERAEIAEAIRLHTIVTGKGPTGWYTGRCSVNTLDLVTEAGGFD
YVSDSYADDLPYWHEHAGRHQLVIPYTLDANDMRFATPQGFNSGDQFFSYLKDSFDVLYA
EGTAGAPKMMSIGLHCRLAGRPGRAAALARFLDYVKGHEKVWVARRIDIARYWAEAYPFR
PNENRPSRLSKDDFISRFGGVFEHSDWIARRAFAGELAPANDTASGLHAALCAVFREASE
EERLAVLNAHPDLAGKLAQAKRLTESSTSEQASAGLDALTDEERERFTALNDAYVEKFGF
PFIMAVKGRSKDEILAAFETRIGNDGKAEFNTACLQVERIALLRLREMLPE
Download sequence
Identical sequences A6UID6
WP_012061549.1.7720 YP_001313349.1.44884 366394.Smed_4618 gi|150376753|ref|YP_001313349.1|NC_009620 gi|150376753|ref|YP_001313349.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]