SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376755|ref|YP_001313351.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376755|ref|YP_001313351.1|
Domain Number 1 Region: 189-368
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.91e-55
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000111
Further Details:      
 
Domain Number 2 Region: 373-481
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.44e-34
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0001
Further Details:      
 
Domain Number 3 Region: 100-209
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.24e-32
Family CO dehydrogenase ISP C-domain like 0.00019
Further Details:      
 
Domain Number 4 Region: 8-92
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.93e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376755|ref|YP_001313351.1|
Sequence length 493
Comment xanthine dehydrogenase small subunit [Sinorhizobium medicae WSM419]
Sequence
MTIEFRNTIRFLLNDRSVELADVSPVQTLLDFLRIDRNLRGTKEGCAEGDCGACTVLVGR
LLDGKLRYESVNACIRFVASLDGCHVVTVEALAQPNGPLHPVQQAMVDTHASQCGFCTPG
FVMSLYGLWMANAKPSIQQIEKALQGNLCRCTGYAAIIRAAEAIASVGELGKDPLIVERE
QITRQLKALQDGRRVEIGGEDERVVLPASLDDFAAVLQANPKATIVAGSTDVGLWVTKFM
RNIAPVVHLSHLEELRRISVGVDGITLAAGVSYTEAYPAIVRHFPQLRELWDRIGGEQVR
NMGTVGGNIANGSPIGDTPPALIALGASVTLRKGTNRRTLPLEAFFLEYGKQDRESGEFV
ESVRIPFLDETHRFAVYKISKRFDEDISAVCGAFRVKLDGDGRVADVAIAFGGMAGTPKR
ARNVEAALKGAQWNDAAVEAGVAAFERDFAPLTDWRASSEYRMLVARNLLRRFHLETQET
RHVRIDRTVAVAM
Download sequence
Identical sequences A6UID8
366394.Smed_4620 WP_012061551.1.7720 YP_001313351.1.44884 gi|150376755|ref|YP_001313351.1| gi|150376755|ref|YP_001313351.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]