SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376798|ref|YP_001313394.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150376798|ref|YP_001313394.1|
Domain Number - Region: 55-128,161-226
Classification Level Classification E-value
Superfamily LigT-like 0.000131
Family 2'-5' RNA ligase LigT 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150376798|ref|YP_001313394.1|
Sequence length 235
Comment hypothetical protein Smed_4664 [Sinorhizobium medicae WSM419]
Sequence
MRYAIYFAPPSDDRLSQTASRWLGRDAFTGGALDCPENPALGREDQMVLTAEPRRYGFHG
TLKAPFELTPQRSEADLIAAFDEFAAEIEPFEVPSIALHQIGPFFALVSAKACPELQHLA
EQAVRRFEPFRAALSEADLARRNPERLTQRQREYLAAWGYPYVFDEFQFHLTLTGPVPEE
MHRPMRKALETVFAEFIGKRLAVSTIALFAEERRGAPFTVHSLLPLGGASERKIA
Download sequence
Identical sequences A6UII1
gi|150376798|ref|YP_001313394.1|NC_009620 gi|150376798|ref|YP_001313394.1| 366394.Smed_4664 YP_001313394.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]