SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376807|ref|YP_001313403.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376807|ref|YP_001313403.1|
Domain Number 1 Region: 231-482
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.96e-87
Family Hsp90 middle domain 0.000000905
Further Details:      
 
Domain Number 2 Region: 8-217
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.52e-62
Family Heat shock protein 90, HSP90, N-terminal domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 511-624
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 3.27e-28
Family HSP90 C-terminal domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150376807|ref|YP_001313403.1|
Sequence length 631
Comment heat shock protein 90 [Sinorhizobium medicae WSM419]
Sequence
MSEVETSVEKHVFEADVAKLLHLMVHSVYSDKNVFLRELISNAADACEKLRYEAIVAPEL
LGSDPTSRITLTLDEENARLTIEDNGIGMGRDELVESLGTIARSGTRAFMERIEAAQNKD
GAQLIGQFGVGFYSAFMVADNVDVVSRRAGTDKAWLWASDGKGSYTVSAFDLADAPARGT
RITLHLMEDAKTFTSRWTVEGIVKEQSGHVPVPISIVEKPGAEPVQVVDGTALWTKQKSE
ITTEDYTDFYRGVAGQYDEPALTVHFRAEGRHEYTALAFVPGSKPFDLFDPDRKGRMKLY
VKRVFITDEAELLPRYLRFVRGLVDTADLPLNVSREMIQESPLLANIRKGVTNRVLTSIE
KLAESDPEAFAKLWENFGSVIKEGIYEDFERRAQLLALSRFRTTVDDEKPRSLSDYVKEM
KEGQTAIYYLTGDNLAQLKASPQLEGFRARGIEVLLLTCPVDSFWVTTAPDFEGKPFKSI
TQGAADLAGIAKKNDAAAAASAEAGVAVTDFLAFAKETLGDAVSDVRTSDRLTESAVCLV
ATEQGPDLQLQKMLQGAGRIESAAKPVLEVNPGHQLITALAGCPGEDKTFREDAVKLLFD
QARVLDGDKPEDPRAFAERLTRVFSRALKGS
Download sequence
Identical sequences A6UIJ0
YP_001313403.1.44884 gi|150376807|ref|YP_001313403.1| 366394.Smed_4673 gi|150376807|ref|YP_001313403.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]