SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376868|ref|YP_001313464.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376868|ref|YP_001313464.1|
Domain Number 1 Region: 1-220
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.89e-58
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000858
Further Details:      
 
Domain Number 2 Region: 225-325
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.83e-26
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150376868|ref|YP_001313464.1|
Sequence length 328
Comment FAD-binding molybdopterin dehydrogenase [Sinorhizobium medicae WSM419]
Sequence
MQPFTYQRSEDAAGAVAAVAGRPAARFISGGTNLLDLMKLDIERPQHLVDISRLPLDRVE
PTEEGGLHIGAQVRNSDLAADPGVRSRYPILSQALLAGASGQIRNKASTGGNLLQRTRCP
YFYDSNMPCNKREPGAGCAALRGFNRMHAVIGASDSCIAVHPSDMAVAMAVLDARVETVS
PGGETRSIPLGDLYLLPGTTADEETVLAHGEMITGVTLPPPPAGRQVYRKVRDRASYAFA
LVSVAAIIETSGNRVRSARVAMGGVAPKPWRAPEVESRLAGSALSDQALSEAAEAALPEA
VGHGGNDFKIRLAKRTVRYTLAAAAELV
Download sequence
Identical sequences A6UIQ1
gi|150376868|ref|YP_001313464.1|NC_009620 366394.Smed_4734 YP_001313464.1.44884 gi|150376868|ref|YP_001313464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]