SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150376919|ref|YP_001313515.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376919|ref|YP_001313515.1|
Domain Number 1 Region: 74-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.76e-29
Family Nitrogenase iron protein-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376919|ref|YP_001313515.1|
Sequence length 255
Comment chromosome partitioning ATPase [Sinorhizobium medicae WSM419]
Sequence
MEHAETTLHEFPEAERLSRIGAEPVWKMLSPCRADPRSVAGSWFVTTGRSNPKHAAFDML
RTKLLLALQQKNWKTVAITSPTPGCGKTFVALNLAFSLANQKDCRTVLVDLDLKRPQIAK
TLGIEAPSTIEKYLKGESEIGDVFQRYSDNLAIGASKQAVPFSAELLQTRGAVKQLQEMQ
QKMNPDVVLFDMPPMLSNDDVVGFLPNVDCVILIAASEQSTLAEVDICEQELSERTNVLG
VVLNKCRFAPEKYGY
Download sequence
Identical sequences A6UIV2
366394.Smed_4787 gi|150376919|ref|YP_001313515.1|NC_009620 gi|150376919|ref|YP_001313515.1| WP_012061715.1.7720 YP_001313515.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]