SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376996|ref|YP_001313592.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376996|ref|YP_001313592.1|
Domain Number 1 Region: 8-391
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.21e-98
Family Phosphonoacetate hydrolase 0.00000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150376996|ref|YP_001313592.1|
Sequence length 424
Comment phosphonoacetate hydrolase [Sinorhizobium medicae WSM419]
Sequence
MNQMSKISVTVNGRRYPWPRVPAIAICLDGCEPAYLDAAMEAGLMPALKRIKERGAVRLA
HSVIPSFTNPNNLSIATGTPPAVHGICGNYLYEPATGEEVMMNDPKFLRAPTIFQAFYDA
GARVAVVTAKDKLRALLGKGLRFDEERAICFSSEKSDKATPEEHGIDNASGWLGRPVPEV
YSAALSEFVFAAGVKLLKEFHPDIMYLTTTDYVQHKYAPGVAEANAFYAMFDRYLSELDG
LGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGEEAARVILPITDPYVVHHGALGS
FATAYLPGQCDRGEIIDRLKALDGIDVVLDREEACRRFELPEDRIGDIVLVSSENKTLGT
SEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPDLPGAPCLRNFDAFFYAVAAAALISA
EDAI
Download sequence
Identical sequences A6UJ29
gi|150376996|ref|YP_001313592.1|NC_009620 366394.Smed_4875 gi|150376996|ref|YP_001313592.1| WP_012061791.1.29075 WP_012061791.1.61285 YP_001313592.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]