SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377087|ref|YP_001313683.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377087|ref|YP_001313683.1|
Domain Number 1 Region: 183-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.19e-70
Family D-glucarate dehydratase-like 0.00000012
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.17e-39
Family Enolase N-terminal domain-like 0.0000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377087|ref|YP_001313683.1|
Sequence length 425
Comment mandelate racemase/muconate lactonizing protein [Sinorhizobium medicae WSM419]
Sequence
MTRITDLRVFDLRFPTSASLDGSDAMNPDPDYSAAYVILDTDRPGLAGHGLTFTIGRGND
VCCMAIQAMRHLVVGQDIGDILKHPGRFWRHLTSDSQLRWIGPEKGAIHLATGAIVNAIW
DLLAKDAGKPVWRLVSEMSAEEIADIVDYRYITDVLTRDEAIEILRRAETGKADRIAALE
KEGYPCYTTSAGWLGYDDEKLRRLAQEAVDAGFNHIKMKVGRDLADDMRRLRIAREVIGP
DRYLMIDANQVWEVGEAIDWVQKLAFAKPFFIEEPTSPDDVAGHRKIREAIGPVKVATGE
MCQNRIMFKQFIAEGAIDIVQIDSCRMGGLNEVLAVLLIAAKYGLPVWPHAGGVGLCEYV
QHLSMIDYVAVSGTKDGRVIEYVDHLHEHFLDPCVISDAAYMPPSRPGFSIEMKEKSIED
YTFRG
Download sequence
Identical sequences A6UJC0
WP_012061878.1.61285 YP_001313683.1.44884 gi|150377087|ref|YP_001313683.1|NC_009620 gi|150377087|ref|YP_001313683.1| 366394.Smed_4969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]