SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377093|ref|YP_001313689.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377093|ref|YP_001313689.1|
Domain Number 1 Region: 115-358
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.41e-72
Family D-glucarate dehydratase-like 0.0000796
Further Details:      
 
Domain Number 2 Region: 3-128
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2e-30
Family Enolase N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150377093|ref|YP_001313689.1|
Sequence length 370
Comment mandelate racemase/muconate lactonizing protein [Sinorhizobium medicae WSM419]
Sequence
MARIERIELRMVDLPPKVKRTDAIQSFVSQETPIVTITDSDGAAGTGYSYTIGTGGSSVM
RLLSDHLVPMLIGEDADCIEALWHKMEFATHATTIGAITALALAAVDTALWDLRARKQKL
PLWKLAGGAKESCPLYTTEGGWLHIEKQALVEDALQAKAKGFSGSKVKIGKPSGAEDYDR
LAAMRAALGDGFEIMTDCNQGFTVDEAIRRAARLRELDLAWIEEPLPADDLDGHIRLTRS
TSTPIAVGESIYSIRHFREYMQKGACSIVQVDVARIGGITPWLKVAHAAEAFDIPVCPHF
LMELHVSLVCAVPNGKYVEYIPQLDDLTQKGMEIREGRAIAPSDPGIGIAWDWEAVKARS
VAEFTREFRR
Download sequence
Identical sequences A6UJC6
gi|150377093|ref|YP_001313689.1|NC_009620 366394.Smed_4975 gi|150377093|ref|YP_001313689.1| WP_012061884.1.61285 WP_012061884.1.89664 YP_001313689.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]