SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377100|ref|YP_001313696.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377100|ref|YP_001313696.1|
Domain Number 1 Region: 15-283
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.78e-57
Family PA1517-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150377100|ref|YP_001313696.1|
Sequence length 292
Comment polysaccharide deacetylase [Sinorhizobium medicae WSM419]
Sequence
MTYDLTPRPLNKAPRTPAMTWPNGARSAVFIGFDVDAETAWIGNSPSNIDRMVTTSHGGY
DARVGIARIVGLMDELGLKATFFTPGWTALAHPEACETILRAGHEIGHHGYLHKMPDRDR
LDETFEEIDRGFDALQRVFGKRPVGYRAPSGENFPELIAYLARSGIRYSSSFRDDILPYR
HAASDGMPGPVEIPINFAFDDWNFGMSSRASPRPLFGREAVLSLWIDEFEATHAWGGVTT
LVLHPQVSGRPMRWHLLRDFLRHVQEKGDVWIATGEEITNHFEALERHRGAS
Download sequence
Identical sequences A6UJD3
WP_012061891.1.61285 YP_001313696.1.44884 gi|150377100|ref|YP_001313696.1|NC_009620 366394.Smed_4982 gi|150377100|ref|YP_001313696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]