SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377217|ref|YP_001313812.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377217|ref|YP_001313812.1|
Domain Number 1 Region: 128-364
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.54e-60
Family D-glucarate dehydratase-like 0.00061
Further Details:      
 
Domain Number 2 Region: 2-133
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.38e-27
Family Enolase N-terminal domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150377217|ref|YP_001313812.1|
Sequence length 374
Comment mandelate racemase/muconate lactonizing protein [Sinorhizobium medicae WSM419]
Sequence
MVKISGIRVRPLVLPLKQPYHWSYGIRESFAVNLIEIEADDGSVGIGECTVAPDQAGTAA
ILHRLAGHLIGHSPHDVAPLIARIFHQEYLGHGANIMRAANQVFSGIDMAMWDLQGKLAG
LPVHQLLGGAHRKAVGYFYFLQGETAEELARDAAAGRARGERVFYLKVGRGEKTDLEITA
AVRREIGDARLRLDANEGWSVHDAINMCRKLEKYDIEFIEQPTVSWSIPAMAHVREKVGI
PIVADQAAFTLYDVYEICRQRAADMICIGPREIGGIQPMMKAAAVAEAAGLKICIHSSFT
TGITTCAEHHIGLAIPNLDDGNQIMWQLVQKDIVSSPDLAPRNGWLDAFKKPGLGFQLAE
DLIADGERRFAASR
Download sequence
Identical sequences A6UJP9
gi|150377217|ref|YP_001313812.1| gi|150377217|ref|YP_001313812.1|NC_009621 366394.Smed_5102 WP_011969989.1.29075 WP_011969989.1.89664 YP_001313812.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]