SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377289|ref|YP_001313884.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377289|ref|YP_001313884.1|
Domain Number 1 Region: 62-157
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.00000000000000159
Family ParB-like nuclease domain 0.0057
Further Details:      
 
Domain Number 2 Region: 148-221
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.000000275
Family KorB DNA-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150377289|ref|YP_001313884.1|
Sequence length 334
Comment parB-like partition protein [Sinorhizobium medicae WSM419]
Sequence
MSRKDSKGLFANVLGQLENSAEKGGMQRSSSPHLLKVAAGVRQMQERSELAERLLKDGGQ
IVDIDPDEIMESAIRDRFDSGYSGASIADLVESMREHGQSTPGLVRPVRGAAKPFQIVFG
RRRLAAAKLLGIKFKTIARELSDEDAIVLQGEENSNRKDLSFIERCFFAQSQETAGYRRD
VICKSLSTGRSHISEMIRIATALPREILMQIGPAPEIGRRRWLEFELRWSAHKDPGHVAQ
LVLERDEIQSASSDLRFAAVFEALSKADGKPAASSATSDLISHGLVLGQVQRSKSASRLT
FNKSVPTGFVDFIAGQIESLHDQFMQRQNSKRGD
Download sequence
Identical sequences A6UJX1
gi|150377289|ref|YP_001313884.1|NC_009621 gi|150377289|ref|YP_001313884.1| WP_011970060.1.61285 YP_001313884.1.44884 366394.Smed_5174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]