SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377361|ref|YP_001313956.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377361|ref|YP_001313956.1|
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily Globin-like 7.48e-43
Family Globins 0.000000957
Further Details:      
 
Domain Number 2 Region: 263-398
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.7e-37
Family Flavohemoglobin, C-terminal domain 0.0000033
Further Details:      
 
Domain Number 3 Region: 151-260
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 8.51e-30
Family Ferredoxin reductase FAD-binding domain-like 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150377361|ref|YP_001313956.1|
Sequence length 403
Comment nitric oxide dioxygenase [Sinorhizobium medicae WSM419]
Sequence
MLTQKTKDIVKATAPVLAEHGFAIIQHFYKRMFQAHPELKNIFNMAHQERGEQQQALARA
VYAYAANIEDPESLSAVLKDISHKHASLGVRPEQYLIVGEHLLASIKEVLGDAVTDDIIS
AWAQAYGNLADILAGMESALYERSAERPGGWTGWRQFIVREKQPESDVITSFVLEPADGG
PVADFEPGQYISIAVQVPRLGCQQIRQYSLSDSPNGRSYRISVKREEGTSGTPGYVSSLL
HDHVEVDDEIKLAAPYGNFYIDVSATSPIVLISGGVGLTPMISMLRKALQTPPRKVAFVH
GARNSAVHAMRDRLKEAARTYPDFSLFIFYDEPLPIDVEGQDYDYAGLVDLERIKDGILL
EGADYYICGPVPFMRMQHDKLLQLGIPEARIHYEVFGPDLFAE
Download sequence
Identical sequences A6UK43
366394.Smed_5247 gi|150377361|ref|YP_001313956.1| WP_011970132.1.29075 YP_001313956.1.44884 gi|150377361|ref|YP_001313956.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]