SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377507|ref|YP_001314102.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377507|ref|YP_001314102.1|
Domain Number 1 Region: 460-562
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.92e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150377507|ref|YP_001314102.1|
Sequence length 577
Comment sulfate transporter [Sinorhizobium medicae WSM419]
Sequence
MKVSTDRQSEAPGFAELYTPKFLTILREGYGLPHLRADAIAGLTVAIVALPLSMAIAIAS
GATPAQGLYSAIVGGFFVSLFGGSRFQIGGPAGAFIVLVAATVAQHGMDGLILATFLSGL
MLTAVGLLRFGTFIKFIPFPVTVGFTAGIAVIIFASQIKDLFGLTLDHEPGELLQKLPVL
WGAKDSVASGAVGISITTIAVILGLRRWRPRWPGMLIAVALSSTATALLALPVETIGTKF
GGIPSALPFPQLPDLSMDRIVAVLPAALSFTLLGSIESLLSAVVADGMTGRRHRSNCELV
AQGAANIGASLFGGFCVTGTIARTATNIRAGAHGPVAGMLHSAFLLIFMVIAAPLAAYIP
LAALAGVLAVVAWNMIEKPAIAILLRSGWGEATVLGATFFLTVFRDLSEAIVVGFALGSV
LFIHRMSRTTAVTTHVPFVARDEADDAHPRKAYNESAAANPDVVVYRITGALFFGATASI
GSVLDRIQDNQKALVVDFSAVPFLDSTGANMIEGLAHKAHKHGVTLWLTGTTRDIRRVLL
KHEIKRPLVRYAATVEAAISALQRARTTLRAGPTQAA
Download sequence
Identical sequences A6UKI9
WP_011970278.1.29075 WP_011970278.1.7720 WP_011970278.1.89664 YP_001314102.1.44884 366394.Smed_5404 gi|150377507|ref|YP_001314102.1| gi|150377507|ref|YP_001314102.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]