SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377566|ref|YP_001314161.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377566|ref|YP_001314161.1|
Domain Number 1 Region: 2-217
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.92e-75
Family FAD-linked oxidases, N-terminal domain 0.0061
Further Details:      
 
Domain Number 2 Region: 190-471
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 1.8e-55
Family Vanillyl-alcohol oxidase-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377566|ref|YP_001314161.1|
Sequence length 473
Comment FAD linked oxidase domain-containing protein [Sinorhizobium medicae WSM419]
Sequence
MNVLGQLAEIVGGEMIITGVAEMASATEDWRGRYHGAALCVTRPADTTQVSEIVACCHRH
GVPVLPQGGNTGLVGGSVPASTGVAPVIVSLDRMRRIRSVDPVNSTIEVEAGCVLANVHD
AAKSANRFYPVSLGSEGSCQIGGTIATNAGGTSVLRYGTTRDNVLGLEVVLPDGTIWSGL
TGLRKNNTGYDLKHLFIGSEGTLGIITAAVLKLHPFPARTAVAWAGLDCPEDALKMLTLI
QGTYGAKLSGFELMNRLQLDLVVKHVPQRRSPIETEHDWHLLIELSDSGGEGDLDEALQA
VLEKGFSAELVANAVIAASEAQRAALWEVRHSVSEANKKAGVGLTTDCAVPVSATADFIS
KATENVHAIAPAASVVVVGHVGDGNIHFIPFFTFDAWNGLAERDALSLRIRHAVNDVAAA
LGGTFSAEHGVGQVQLAEMDRYKQPAELALMRVVKAAIDPKGLFNPGRLLPNT
Download sequence
Identical sequences A6UKP8
366394.Smed_5468 gi|150377566|ref|YP_001314161.1|NC_009621 YP_001314161.1.44884 gi|150377566|ref|YP_001314161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]