SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150377613|ref|YP_001314208.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377613|ref|YP_001314208.1|
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily CheY-like 6.83e-29
Family CheY-related 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150377613|ref|YP_001314208.1|
Sequence length 122
Comment response regulator receiver protein [Sinorhizobium medicae WSM419]
Sequence
MKTQKPLVSVVDDDESVREALPDLIRIFGFDVRAFSSADEFLASEWLKDTDCLVLDVAMP
GMSGPELQEELARRGEKIPIIFITAHKDESERIPLLQSGAVDCLFKPFSDVALQDALDRA
LR
Download sequence
Identical sequences A6UKU5
366394.Smed_5523 gi|150377613|ref|YP_001314208.1| YP_001314208.1.44884 gi|150377613|ref|YP_001314208.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]