SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377663|ref|YP_001314258.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377663|ref|YP_001314258.1|
Domain Number 1 Region: 4-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.1e-83
Family ABC transporter ATPase domain-like 0.000000219
Further Details:      
 
Domain Number 2 Region: 236-356
Classification Level Classification E-value
Superfamily MOP-like 1.85e-23
Family ABC-transporter additional domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377663|ref|YP_001314258.1|
Sequence length 361
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MAEIRLENVSKSFGSVSVISNISLTVNAGELMVFLGPSGSGKSTLLRMIAGLETIDSGSL
TIGGMRSEALPPGHRNVAMVFQNYALYPHMSVRDNMAFGLENIGLPGAEIETRVLKAARM
LEMENLLSRKPAQLSGGQRQRVAIGRAIVKEPKAFLFDEPLSNLDAALRVRTRVELAQLH
QRMKSTMIYVTHDQTEAMTLADRIVVLNQCKIEQIGTPMEVYLKPASRFVAGFIGSPGMN
FVPVDVIRPGRTPIRFGNGFELEIEAPVPAPGRFDLGIRPESVRIMTGENDPSRPSIEAQ
VGVVEQLGERTLAYCTLEDGSQLIAQDAGRSEVRPGDRVRVGLDPLAVHLFDAAGKSYQA
I
Download sequence
Identical sequences A6UKZ5
WP_011970433.1.29075 WP_011970433.1.61285 WP_011970433.1.7720 WP_011970433.1.89664 YP_001314258.1.44884 gi|150377663|ref|YP_001314258.1| gi|150377663|ref|YP_001314258.1|NC_009621 366394.Smed_5579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]