SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377667|ref|YP_001314262.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377667|ref|YP_001314262.1|
Domain Number 1 Region: 16-383
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.74e-115
Family beta-glycanases 0.000000000468
Further Details:      
 
Domain Number 2 Region: 364-500
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.55e-33
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150377667|ref|YP_001314262.1|
Sequence length 502
Comment Alpha-N-arabinofuranosidase [Sinorhizobium medicae WSM419]
Sequence
MEARVTAHSRYTIADIDKRLYGSFLEHLGRAVYTGIYEPGHPTALPNGMRKDVIDLVREL
DTPICRYPGGNFVSAYNWEDGIGPKEGRPTRLDLAWRTSESNQVGIHEFAEWAEAAGTEM
MLAVNLGSRGLDAARNFVEYVNHPGGSQWSDLRRQNGRAEPWNVKLWCLGNEMDGPWQVG
HKSAAEYGHLANETAKAIRAFDDKLELVVCGSSHSDMATYPRWEATVLDATYDQVDYISL
HMYFENYEKRTSEFLALPEKLDRYIGTVSGVIDFVKGSKRSNRDVKISFDEWNVWYHERK
NDAKRMREWNWPHAPVLLEDIYNFEDVLQVGCIINTFIRRSDVVRVACIAQLVNVIAPIM
TEPGGSSWRQTIYHPLHLASRYGRGTALQLDVDCATYVSNVSEAVSYLDIAGVHDADAGT
LTFFAVNRHSSEAASIKLAVERFGTIRGVEHTLIKHDDLEARNTKDNPDNVSPRKTSDAV
MDGNSVSVSVPPYSYSMIRIRL
Download sequence
Identical sequences A6UKZ9
366394.Smed_5583 WP_011970437.1.89664 YP_001314262.1.44884 gi|150377667|ref|YP_001314262.1| gi|150377667|ref|YP_001314262.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]