SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377812|ref|YP_001314407.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377812|ref|YP_001314407.1|
Domain Number 1 Region: 30-518
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.34e-104
Family Arylsulfatase 0.00000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377812|ref|YP_001314407.1|
Sequence length 555
Comment sulfatase [Sinorhizobium medicae WSM419]
Sequence
MNRRIMRGVGAFAASTVLWCTASSLNAQEAQPKPNILFIVSDDTGYGDLGPYGGGEGRGM
PTPNIDRLADEGMTFFSFYAQPSCTPGRAAMQTGRIPNRSGMTTVAFQGQGGGLPAAEWT
LASVLKRGGYQTYFTGKWHLGEADYALPIAQGYDEMKHVGLYHLNAYTYADPTWFPDMDP
ELRAMFQKVTKGSLSGKAGGEVKEDFKINGQYVDTPVIDGKEGVVGIPFFDGYVEKAAIE
FLDSAAKKPDQPFFINVNFMKVHQPNLPAPEFQHKSLSKSKYADSVVELDTRIGRILDKL
RETGMDKNTLVFYTTDNGAWQDVYPDAGYTPFRGTKGTLREGGNRVPAIAKWPGKIKARS
KNHDIVGGLDLMATFAAVGAVPLPDKDREDKPIVFDSYDMSPILLGTGKSARESWFYFTE
NELSPGAIRVNNYKFAFNIRGDDGASTGGLAVDTNLGWKGAEKYVATVPQVFDLWQDPQE
RYDIFMNNFTERTWMGVVMGEELKKIMATYVQYPPRKPQSLTYNGPITLSDYERFQWVRD
SLAKEGVSISLPTGN
Download sequence
Identical sequences A6ULE4
gi|150377812|ref|YP_001314407.1| WP_011970582.1.89664 YP_001314407.1.44884 366394.Smed_5768 gi|150377812|ref|YP_001314407.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]