SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377842|ref|YP_001314437.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377842|ref|YP_001314437.1|
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily YefM-like 0.000000000131
Family YefM-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150377842|ref|YP_001314437.1|
Sequence length 92
Comment prevent-host-death family protein [Sinorhizobium medicae WSM419]
Sequence
MTSTVTAAAVSKNFGAYQDAAVREPVIITKNGRPRTVLLAYEDYLRLSRRDRPVEATADL
SDNDLAAVEKSEMKPGFDHLNAELLTDKHAAD
Download sequence
Identical sequences A6ULH4
366394.Smed_5802 WP_011970612.1.89664 YP_001314437.1.44884 gi|150377842|ref|YP_001314437.1| gi|150377842|ref|YP_001314437.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]