SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150377856|ref|YP_001314451.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377856|ref|YP_001314451.1|
Domain Number 1 Region: 153-220
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000114
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0027
Further Details:      
 
Domain Number 2 Region: 224-318
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000000157
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|150377856|ref|YP_001314451.1|
Domain Number - Region: 78-152
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0128
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377856|ref|YP_001314451.1|
Sequence length 345
Comment mechanosensitive ion channel MscS [Sinorhizobium medicae WSM419]
Sequence
MFGDDNFVPVILVNLLGTAGIVVWHIQGGNRPTSRLLVQILFFTGMSLVLYMAGIAPHRP
DGLYTQGFGALLSKSARILWWTHLAWAIIGFIQIYFRLNRKPREARLIQDMAIAIIYLGV
ALSVIGFVFDMPVGTLVTTSGVIAVIFGLALQNTLGDVFSGIALTLGRAYAIGDWIHLTD
GTEGRIIETNWRSTNLLTVTHNVVVLPNSILAKQGVTNLSRPDETHQIAVRVRIAATQAP
RLVDEVMRSVLQSSVLIIKNPPPVVVLKAIDAIAIEVELQFHVDSVAVRTPARNEIVDLI
HDQCKVGGLSLAMPAESLAFVPAPMGNNAAVSNDSFISIDLGRRR
Download sequence
Identical sequences A6ULI8
366394.Smed_5823 YP_001314451.1.44884 gi|150377856|ref|YP_001314451.1| gi|150377856|ref|YP_001314451.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]