SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150377878|ref|YP_001314473.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377878|ref|YP_001314473.1|
Domain Number 1 Region: 14-84
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000108
Family Tetracyclin repressor-like, N-terminal domain 0.008
Further Details:      
 
Weak hits

Sequence:  gi|150377878|ref|YP_001314473.1|
Domain Number - Region: 90-201
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000311
Family Tetracyclin repressor-like, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377878|ref|YP_001314473.1|
Sequence length 205
Comment TetR family transcriptional regulator [Sinorhizobium medicae WSM419]
Sequence
MPLLPFGKESHLTRKAKELTRNDWVLAGLAALAEGGIDSVRVERLAKSLNVSKGSFYWHF
SDRSDLLSALLDLWEKDFTAQLIANVASQPTPRARLLALAEEALDASMDGVDVAQAEGAF
SAWAVLDPAAAVRVRAIEAQRIGYLVRELSLMGADTAQAELLAKGIYLALLGVFAARRYN
PALAEDAVFRRIVALALDAVGGRRR
Download sequence
Identical sequences A6ULL0
gi|150377878|ref|YP_001314473.1| WP_011970648.1.29075 WP_011970648.1.61285 WP_011970648.1.89664 YP_001314473.1.44884 366394.Smed_5846 gi|150377878|ref|YP_001314473.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]