SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377902|ref|YP_001314497.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377902|ref|YP_001314497.1|
Domain Number 1 Region: 481-586
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.18e-27
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0076
Further Details:      
 
Domain Number 2 Region: 276-370
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.62e-25
Family Ferredoxin reductase FAD-binding domain-like 0.00079
Further Details:      
 
Domain Number 3 Region: 7-115
Classification Level Classification E-value
Superfamily ISP domain 1.13e-24
Family Ring hydroxylating alpha subunit ISP domain 0.0094
Further Details:      
 
Domain Number 4 Region: 377-491
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.27e-24
Family Aromatic dioxygenase reductase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377902|ref|YP_001314497.1|
Sequence length 588
Comment ferredoxin [Sinorhizobium medicae WSM419]
Sequence
MLDTAKTRWHPIAASYDLPFRHVFHAQLLGREFAVWRADDGYVNIWENRCLHRGVRLSIG
INDGRELKCQYHGWRYSNRTAGCTYIPAHPADAPARTITNRTFAGVERYGLVWSAEEPHG
RVPDVAGLREGEQLALRGIPLNAPADAVVSALTGYRFQPNGRLQGNTANVSLEGSDTFSV
ALRAYEEGAETLVVFFVQPVDSSRSVIRGVLDAGPQGAERLAILRHHNERLSKLREIAER
EAQAAPQPAPLEPVIERVSPELAEMPEMTAHGRKATIRVTVARKWLAADGIAAFELRPVQ
GLLPTFQPGAHIDVHMPNGLVRQYSITNGPGESDSYVIGVKLERDSMGGSLCMHETVREG
DLLAISEPRNNFPLRRDAVRTIFVAGGIGVTPLLAMAQALKNQNLDYEFHYFAQNQEQLA
FPEKTALLGEALKPHLGFLPETTAAKLKEILSGYRPDMHVYLCGPGPMLEAARRIAADLG
WPETAVHFEYFKNTNTIDDSSSFEVALARSCVTLQVTAGKTILETMREAGIDMPSSCEQG
ACGTCLATVIEGEPDHQDVYLNDAERKSGTKIMTCVSRARSARLVLDL
Download sequence
Identical sequences A6ULN4
WP_011970672.1.29075 YP_001314497.1.44884 gi|150377902|ref|YP_001314497.1|NC_009621 gi|150377902|ref|YP_001314497.1| 366394.Smed_5870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]