SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150377909|ref|YP_001314504.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377909|ref|YP_001314504.1|
Domain Number 1 Region: 20-77
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000818
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377909|ref|YP_001314504.1|
Sequence length 260
Comment streptomycin 3''-adenylyltransferase [Sinorhizobium medicae WSM419]
Sequence
MQSATPPQPSDQALAASETISRILQDALLAVYLHGSAVSGGLRPQSDVDLLAVTDRPMTD
EQRRALLSALLRISGRHPRPPGAPRCVELMVFLQVDISAPMFPVRAEFIYGEWLRDAFES
GQLPMPVSDPENTLVLAQARQEAVPILGPEPTGLLPSIPLEHVRGAMREALPVLVDGLHG
DERNVLLTLARMWRTSVSGDFITKDAAAEWAANQMPDTEAQTLLYARDAYLGRVNDEWSN
RKTAAQRTAALLRQRVAEAL
Download sequence
Identical sequences A6ULP1
gi|150377909|ref|YP_001314504.1| WP_011970679.1.29075 WP_011970679.1.61285 WP_011970679.1.89664 YP_001314504.1.44884 366394.Smed_5877 gi|150377909|ref|YP_001314504.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]