SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377993|ref|YP_001314588.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377993|ref|YP_001314588.1|
Domain Number 1 Region: 113-256
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.17e-33
Family Flavohemoglobin, C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 248-363
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.97e-27
Family 2Fe-2S ferredoxin-related 0.02
Further Details:      
 
Domain Number 3 Region: 21-122
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.68e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377993|ref|YP_001314588.1|
Sequence length 364
Comment ferredoxin [Sinorhizobium medicae WSM419]
Sequence
MRRVKWLRSEQMTQFKQLSFWSDAEPLECVTRTPEAPNVVTFSFQSPSGALFNHDPGQFV
TLELPAPGGPLYRTYTISSAPSRPTALTITVKAQDGSTGTRWMLDNLHKGMRIRASGPAG
KFSIVHHPADKYLFISAGSGITPMVAMTTWLYDSGREPDIVFINCARRPSEIILRDRIEL
MASRIVGIDLKWVVEEPDPFRPWTGYRGIFNQIMLGLIAQDYLEREVFCCGAEPFMRAVR
EALAGLGFDMDRYHQESFTAEPAHAEDVPEDVVPDEQNQAEIAFALSGITAKCKETDSIL
AAAKAVGLVIPSGCAMGICGTCKVRKTEGQVHMVHNGGITDEDVEDGYILACCSKPLGRV
SVEA
Download sequence
Identical sequences A6ULX5
gi|150377993|ref|YP_001314588.1| gi|150377993|ref|YP_001314588.1|NC_009621 366394.Smed_5978 WP_011970763.1.7720 YP_001314588.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]