SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378033|ref|YP_001314628.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378033|ref|YP_001314628.1|
Domain Number 1 Region: 328-564
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.96e-21
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150378033|ref|YP_001314628.1|
Sequence length 580
Comment sulfatase [Sinorhizobium medicae WSM419]
Sequence
MLNADIATLDAPFRSLSAFSFSASDLRIHAREEAGLLNKIKTHRPRLRSEWLSILTTVYL
LFFLNATFWDKSFLYLKGQGFALVALAIGLLAAFVALTVTFSAKYLIKPALIFMVLASVA
SAWFMDRFSVIIDTEMIRNAVETNRAEAGHLITGAFVLHIILFGVLPSLFIAWVEVIHRA
ILKKVMVNLVIIVPSLLVFAGAGLSNGGTFIFSTREHRDWFRTLNPIFPVGSAASFLVDQ
SREQSIILQPIGTDAKVADALPSADRRPRVTIVVVGETARAQNFQLGGYARETNPELTKR
DIIYFKDTSSCGTATAVSVPCMFSVYDRKDYSHAKALATENLVDVLSHAGIKTEWWDNNT
GDKHVADRIKKTDLFKSNDLRFCDGGECLDQILVDGLDAWLDKVNGDAVLVLHQLGNHGP
AYYLRYPEEFRKFMPDCRSADFDTCTPETITNAYDNGLLYTDHILAEVIDTLSAHGDRLD
TAMIYMSDHGESLGENGLYLHGAPYMFAPTQQTHVPFVLWISPGLQQSTRIEKPCLAAKA
DVPHSHDNLFHSVLGLMQVKTQVHDPALDIFAACRDGVSS
Download sequence
Identical sequences A6UM15
gi|150378033|ref|YP_001314628.1|NC_009621 366394.Smed_6033 WP_011970803.1.29075 WP_011970803.1.61285 WP_011970803.1.89664 YP_001314628.1.44884 gi|150378033|ref|YP_001314628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]