SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378122|ref|YP_001314717.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150378122|ref|YP_001314717.1|
Domain Number - Region: 148-218
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0262
Family KorB DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150378122|ref|YP_001314717.1|
Sequence length 227
Comment type IV secretion system protein VirB5 [Sinorhizobium medicae WSM419]
Sequence
MKFTQLTVTTIAACLIMQAPARAQFVVTDPGNTYQAAITAGTTILNYAKTAQMLEQTIAM
VGMFTTNFAVTGLLSQINQGNKYPSTNKLSEQMFDSQRPVSATARAIATDRDRAIDGSDA
HAELLRGQITGAANAASVAADNLELMDKRLRENGNTLGQLSRSRNIMQATVTNGLLLKQI
HDAIIQNSQATSLLTMATAQASLHAAEEAAAQRRERLETAKIFSPGL
Download sequence
Identical sequences A6UMA4
gi|150378122|ref|YP_001314717.1|NC_009621 366394.Smed_6158 WP_011970877.1.29075 WP_011970877.1.61285 WP_011970877.1.89664 YP_001314717.1.44884 gi|150378122|ref|YP_001314717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]